Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GTGCNVEILNQNQVSVGSGCARINSVTNISDNQGRRWGVNANSSCGLSTTQTLPSGWSLTHNGFCNA 5LSZ Chain:A ((195-249)) ----NDEIIDATQ---KGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFD-----

General information: TITO was launched using: RESULT: Template: 5LSZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 124 857 6.91 15.57 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : 6.91 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.115

(partial model without unconserved sides chains): PDB file : Tito_5LSZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5LSZ-query.scw PDB file : Tito_Scwrl_5LSZ.pdb: