Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence NCVANILNINEAVIATGCVPAGGELRIFVGSSHSYLIKATSSCGLSLTNQVFINGESVQSGGRC 2KZB Chain:A ((333-358)) -STIEIENQYGEVIFLGKYGSSPMINL-------------------------------------

General information: TITO was launched using: RESULT: Template: 2KZB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 47 -8718 -185.48 -335.29 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -185.48 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.666

(partial model without unconserved sides chains): PDB file : Tito_2KZB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KZB-query.scw PDB file : Tito_Scwrl_2KZB.pdb: