Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KSLSTGELEEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY 2IUH Chain:A ((21-88)) --------EEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 2IUH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 215 -24042 -111.82 -353.56 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain A : 0.95 3D Compatibility (PKB) : -111.82 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.95 QMean score : 0.833

(partial model without unconserved sides chains): PDB file : Tito_2IUH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2IUH-query.scw PDB file : Tito_Scwrl_2IUH.pdb: