Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAVRGLQLGIKTRTWQGAATGAAGGAILGGVAYAATCWW 1RPB Chain:? ((1-21)) -------------------------------------------------------CLGIGSCNDFAGCGYAVVCFW

General information: TITO was launched using: RESULT: Template: 1RPB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 53 -11741 -221.52 -559.07 target 2D structure prediction score : 0.24 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -221.52 2D Compatibility (Sec. Struct. Predict.) : 0.24 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.195

(partial model without unconserved sides chains): PDB file : Tito_1RPB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RPB-query.scw PDB file : Tito_Scwrl_1RPB.pdb: