Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKLEVKDNKKLVLKSVICKKLHDTKVEDVDQEINRFHQHLQLLKAQIFGPLIVKSCGTTIHDDGLITTDFEFYIQAHNAQQYSNIYDVQDSISVPYCLYVRFEDSPEYLQYAYSKLDLYVYENDIQTDGIVYTVYVNSSPEKMVVDIFIPIVSL 3ZYQ Chain:A ((47-83)) --------------------------VNSIKKKVNDKNPHVALYALEVMES-VVKNCGQTVHDE-------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3ZYQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 64 -10787 -168.54 -291.53 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -168.54 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.454

(partial model without unconserved sides chains): PDB file : Tito_3ZYQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ZYQ-query.scw PDB file : Tito_Scwrl_3ZYQ.pdb: