Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSRVRVQIMNQFHRKSHEYKAIKRYWKLIQQDSRKLSDKRFYRPTFRMHLTNKEILDKILSYSEDLKHHYQIYQLLLFHFQNKDPEKFFGLIEDNLKQVHPIFQTVFKTFLKNKEKIVNALQLPYSNAKIGSDQ 5N9J Chain:X ((92-160)) ----------------------------------KREDKCGIRPVNRAKLTNGSVTEFVEKMGYEFSHEY-IIQGLEYFFFDTTVRIYQTLIPSQQRSIKPPFH------------------------------

General information: TITO was launched using: RESULT: Template: 5N9J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 93 -5226 -56.19 -75.74 target 2D structure prediction score : 0.26 Monomeric hydrophicity matching model chain X : 0.64 3D Compatibility (PKB) : -56.19 2D Compatibility (Sec. Struct. Predict.) : 0.26 1D Compatibility (Hydrophobicity) : 0.64 QMean score : -0.002

(partial model without unconserved sides chains): PDB file : Tito_5N9J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5N9J-query.scw PDB file : Tito_Scwrl_5N9J.pdb: