Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGVVGKQSSSFSLLFWLFSLSSGKVTCFKSGSLGNSSNILPKLSHFVNFTAIGVPRF 4U32 Chain:X ((19-43)) -------------PRWWYNVTDGSCQLFVYGGCDGNSN-------------------

General information: TITO was launched using: RESULT: Template: 4U32.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 41 -4247 -103.57 -169.86 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain X : 0.51 3D Compatibility (PKB) : -103.57 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.792

(partial model without unconserved sides chains): PDB file : Tito_4U32.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4U32-query.scw PDB file : Tito_Scwrl_4U32.pdb: