Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPRYEGSSDCHKSREIVSLDITVNYCHDMKLFKMSRRNIGQAGKILADSGYQGLMKIYPQAQTPRKSSKLKPLTAEDKACNHALSKERSKVENIFAKVKTFKMFSTTYRNHRKRFGLRMNLSAGIINHELGF 3P12 Chain:C ((23-35)) ----------------------------------------FDLLTINDAGMPI-------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3P12.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 5 -16 -3.20 -1.23 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain C : 0.56 3D Compatibility (PKB) : -3.20 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.891

(partial model without unconserved sides chains): PDB file : Tito_3P12.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3P12-query.scw PDB file : Tito_Scwrl_3P12.pdb: