Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEFLLYTISKVKLLEDILMPQPIVPVEIPQSRPFDSKKRNDILLKIRIGKLEVSFFQSLNLEMVEQLLDKVLLYDNSSI 5JFF Chain:D ((22-61)) -----------------------------KSRLWELQRNRNFQASRRLEGVEMPL-VTLTAAEALARLEE---------

General information: TITO was launched using: RESULT: Template: 5JFF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 42 101 2.40 2.53 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain D : 0.53 3D Compatibility (PKB) : 2.40 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.232

(partial model without unconserved sides chains): PDB file : Tito_5JFF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5JFF-query.scw PDB file : Tito_Scwrl_5JFF.pdb: