Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPFVNED 4K0K Chain:R ((15-66)) --------------------------DYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEK-

General information: TITO was launched using: RESULT: Template: 4K0K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 142 -14246 -100.32 -273.96 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain R : 0.80 3D Compatibility (PKB) : -100.32 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.598

(partial model without unconserved sides chains): PDB file : Tito_4K0K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4K0K-query.scw PDB file : Tito_Scwrl_4K0K.pdb: