Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDNSKRPINQIIARINDAAKHGEALVLTAEEVKILSKDIGDKVFIPVLTNEQVVQLVKEGKLGQKIK 4G92 Chain:B ((43-84)) -------ISFITSEASEKCQQEKRKTVNGEDILFAMTSLGFENYAEALK------------------

General information: TITO was launched using: RESULT: Template: 4G92.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 104 -13295 -127.83 -316.54 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain B : 0.66 3D Compatibility (PKB) : -127.83 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.390

(partial model without unconserved sides chains): PDB file : Tito_4G92.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4G92-query.scw PDB file : Tito_Scwrl_4G92.pdb: