Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLIHYPVYFFFELIQASCNEYIASGSNKEDIMLLNRKHSLVSCFDLELLETHPVKIKNSKVKQKNFITVSLEFSFKKIPPIF 3MKR Chain:B ((927-951)) -----------------PVDHILAGSFETAMRLLHDQVGVTQ----------------------------------------

General information: TITO was launched using: RESULT: Template: 3MKR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 42 -3528 -84.00 -141.12 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain B : 0.51 3D Compatibility (PKB) : -84.00 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.521

(partial model without unconserved sides chains): PDB file : Tito_3MKR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3MKR-query.scw PDB file : Tito_Scwrl_3MKR.pdb: