Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKILVRNLDRSVTEAEVLELFKAYGKVESCVVVTDKDTGKSKGFGFVEMPNPHEAIKAIKGLNTLKVKGYGIRVKAAEE 3UWT Chain:A ((111-186)) -RIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKA--

General information: TITO was launched using: RESULT: Template: 3UWT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 305 -52306 -171.50 -688.24 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -171.50 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.771

(partial model without unconserved sides chains): PDB file : Tito_3UWT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3UWT-query.scw PDB file : Tito_Scwrl_3UWT.pdb: