Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------------------------------------------------------------------------------------------------------------------------------------------MNDKELTFKEGHDILKQNAELLE---SQESPDIDNLMKIVEESIGAY---KACKSRIEAVQQALDETFKE----------------- 5GYD Chain:A ((1-268)) GMSFDINWSTLESDNRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAITLKEITDPLDEFYDSIREESPNDIQFLLEVEYKGDLLVTIGADLVLNYPVEKFMTLPVKLSISDIGLHSLCIVACLSKQLFLSFLCDVSDPALD--DNQTVLDPKGPILAATKPLERISIVRSMKIETEIGEQYQGQGSVLRSVGELEQFLFTIFKDFLRKELAWPSWINLDFN

General information: TITO was launched using: RESULT: Template: 5GYD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 71 -118 -1.65 -1.90 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -1.65 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.286

(partial model without unconserved sides chains): PDB file : Tito_5GYD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5GYD-query.scw PDB file : Tito_Scwrl_5GYD.pdb: