Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTKKNNAPELHKYRGLTSTEQMVIHQMLISYVREENCRFNIIMTGTAEPYNLVKLTSINFENEASAIWVHFETITGEQIALPIDFLSRIEFSGQQEI 1F35 Chain:B ((40-61)) --------------------------------------------------------------------------DGEKLIRPAESVYRLDFIQQQK-

General information: TITO was launched using: RESULT: Template: 1F35.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 4 -582 -145.50 -26.45 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain B : 0.56 3D Compatibility (PKB) : -145.50 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.333

(partial model without unconserved sides chains): PDB file : Tito_1F35.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1F35-query.scw PDB file : Tito_Scwrl_1F35.pdb: