Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLPFFIYWGVILACIAWLALSVYFSVFYLVRKENGNLWAFALFNVIAAIVLAITLAVYRTWGWGITQYSSLIYLILAIYGVVVLLQAILGREPKKAAA 2L8V Chain:A ((81-93)) -----------------------------------------------------------------------------------NYKHLLGRAPYDE--

General information: TITO was launched using: RESULT: Template: 2L8V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 9 1020 113.33 78.46 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.31 3D Compatibility (PKB) : 113.33 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.31 QMean score : 1.023

(partial model without unconserved sides chains): PDB file : Tito_2L8V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L8V-query.scw PDB file : Tito_Scwrl_2L8V.pdb: