Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWIAHKMDMSMKLIHQAERYLAEKAYRTQKKEFLPKTAVTNRKENKKERQLFAKGDRIFVNEYQKEALVYEDIGEDTIDVYLDKKIIHVPRQRVRLVRSAEDLYPTGYDLDSLFIDYKTRKRQRDLERGSKKAHKVLVKEMRKRQEERRVNDENSK 4UC7 Chain:B ((50-126)) --------------------------------------------------------------------------EDTIKILRDAGY-HVKANGVDVTTHRQD---KEMKFEVLTLASLTTEIQINIEIESRKSYKKMLKEMGEVAPEYR-------

General information: TITO was launched using: RESULT: Template: 4UC7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 114 -4331 -37.99 -61.00 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain B : 0.65 3D Compatibility (PKB) : -37.99 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.294

(partial model without unconserved sides chains): PDB file : Tito_4UC7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4UC7-query.scw PDB file : Tito_Scwrl_4UC7.pdb: