Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEWMRFFDNRINYDILITKRKRILSVGGRKVKKMEESFPKAVKVENIANILKVTFENGEVKYVKSHWTEEITDALQFGKKGRGKRKNLLALSRNMWIGTEVTIEADGTVFINGKDRYTPEELWYKGKKSIPEL 4AM3 Chain:A ((566-625)) -------------NIPTDKIREVIGSGGKVIREIVATTGAKVDI-NDDGVVKVSASDGAKIKAAIDWIKSITDE-----------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4AM3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 190 -22143 -116.54 -369.05 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -116.54 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.218

(partial model without unconserved sides chains): PDB file : Tito_4AM3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4AM3-query.scw PDB file : Tito_Scwrl_4AM3.pdb: