Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKMKKYKIRKSGNSDVTTIPPEVKEFMGVQTGDAISYVFQSDGSVRMIKAQEEPDIDSLVDSIMNQYEDALKDLVDL 5L6L Chain:D ((7-52)) -HARATGKTFRSGNSEAVRLPRDLA----FGADVELTLIRS-GDVLTIYPSK--------------------------

General information: TITO was launched using: RESULT: Template: 5L6L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 81 -9059 -111.84 -196.93 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain D : 0.62 3D Compatibility (PKB) : -111.84 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.516

(partial model without unconserved sides chains): PDB file : Tito_5L6L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5L6L-query.scw PDB file : Tito_Scwrl_5L6L.pdb: