Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSV------RHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVN 1O48 Chain:A ((7-86)) WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLV-

General information: TITO was launched using: RESULT: Template: 1O48.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 245 -7504 -30.63 -101.40 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -30.63 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.661

(partial model without unconserved sides chains): PDB file : Tito_1O48.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1O48-query.scw PDB file : Tito_Scwrl_1O48.pdb: