Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKLVLLRHGESEANFENYWTGWLDVALTEKGKEQAAVAGQKMLEAGLQFDAVYTSVLKRAILTGQVALEEMGQLWLPIIKTWRLNERHYGDLVGKNKDKMKEIYGKDQVKTWRRGYTEVPPLTAENR-FDR----RYDHLDPHLIPYGESLEMTVNRIIPLWQDHLAPKLKDRQDLLVVGHGNSIRALTKYLEDVPEDQMDTIDIPNAQPIQYTLADDLTILDKKIL
5UM0 Chain:C ((9-234))MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRAIKTCNIVLEESDQLFVPQIKTWRLNERHYGRLQGLDKKQTAEKYGDEQVRIWRRSYDTLPPLLDKDDAFSAHKDRRYAHLPADVVPDGENLKVTLERVLPFWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVIEKFY-


General information:
TITO was launched using:
RESULT:

Template: 5UM0.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 1146 6853 5.98 31.01
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain C : 0.86

3D Compatibility (PKB) : 5.98
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.560

(partial model without unconserved sides chains):
PDB file : Tito_5UM0.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5UM0-query.scw
PDB file : Tito_Scwrl_5UM0.pdb: