Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRYNSIAKVRKLIRRSVLLLKFISWNVNGLRAIVNKNFLEVFHELDADFFCLQETKLQAGQIDL---DLPGYYQYWNY-A-ERKGYSGTAIFAKKPALNATYGMGIDIHDTEGRLITLEYSDFFLVTCYTPNSQSELKRLDYRLEWEEAFYNYLENLKKQKPVIVCGDLNVAHQKIDLKNWKTNQKNAGFTPEERAALSRLLD-NGFIDTFRYFYPTQEGVYSWWNYRFNSRKNNAGWRIDYFLTSKDLEPGLADAKIHTDIMGSDHCPVELDLK
1DE8 Chain:A ((11-275))----------TSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLA


General information:
TITO was launched using:
RESULT:

Template: 1DE8.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1400 14257 10.18 55.04
target 2D structure prediction score : 0.62
Monomeric hydrophicity matching model chain A : 0.83

3D Compatibility (PKB) : 10.18
2D Compatibility (Sec. Struct. Predict.) : 0.62
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.526

(partial model without unconserved sides chains):
PDB file : Tito_1DE8.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1DE8-query.scw
PDB file : Tito_Scwrl_1DE8.pdb: