Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNIIVTGGAGFIGSNFVHYVVNNHPEVHVTVLDKLTYAGNKENLAGLPSDRVELVVGDVADAELVDPSSKRSGRSCSLRGRIP 3EHE Chain:B ((3-72)) --LIVVTGGAGFIGSHVVDKLSESN---EIVVIDNLS-SGNEE----FVNEAARLVKADLAADDIKD-----------------

General information: TITO was launched using: RESULT: Template: 3EHE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 236 -31039 -131.52 -544.54 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain B : 0.75 3D Compatibility (PKB) : -131.52 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.521

(partial model without unconserved sides chains): PDB file : Tito_3EHE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3EHE-query.scw PDB file : Tito_Scwrl_3EHE.pdb: