Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGRMSRRAAERML---RADGDFLVRDSVTNPGQYVLTGMHAGQPKHL-LLVDPEGVVRTKDVLFESISHLIDHH 3C7I Chain:A ((8-83)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3C7I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 249 376 1.51 5.22 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : 1.51 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.760

(partial model without unconserved sides chains): PDB file : Tito_3C7I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C7I-query.scw PDB file : Tito_Scwrl_3C7I.pdb: