Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVKKLTREEVFNKVAKIISNHFEIDTDKVTDELNIKDDLKADSISIMEFVLELEDEFGTEISDEDAEQIETVGGAVDYISSHLK 5H9H Chain:C ((7-80)) ---------ALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGAD-LDVVELIMALEEKFGIEIPDEQAEKIVNVGDVVKYIEDN--

General information: TITO was launched using: RESULT: Template: 5H9H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 260 -48498 -186.53 -664.36 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain C : 0.83 3D Compatibility (PKB) : -186.53 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.729

(partial model without unconserved sides chains): PDB file : Tito_5H9H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5H9H-query.scw PDB file : Tito_Scwrl_5H9H.pdb: