Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence SVETVAASSVKTVPYVWCRLDIYLDKDRRSQRLARNVLFQSGEEGYARGIILEKPYKLYADRDCKTVRLDYEGPSNVRFIPRPERSF 2LAQ Chain:A ((22-28)) ---------------KWCRLNL-----------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2LAQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1 -536 -536.00 -76.57 target 2D structure prediction score : 0.00 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -536.00 2D Compatibility (Sec. Struct. Predict.) : 0.00 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.976

(partial model without unconserved sides chains): PDB file : Tito_2LAQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LAQ-query.scw PDB file : Tito_Scwrl_2LAQ.pdb: