Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence FVQCNHHLLYN-GRHWGT-IRKKAGWAVRFYEEKPGQPKR--LVAICKNASPVHCNYLKCTNLAAGFSAGTSTDVLSSGTVGSIGNDPQAQRQ 5G4H Chain:B ((48-91)) FVEVNKELLFDRAEGIGRRLNIPSGTAARF---EPGEEMEVELTELG----------------------------------------------

General information: TITO was launched using: RESULT: Template: 5G4H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 75 -13003 -173.37 -325.06 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain B : 0.68 3D Compatibility (PKB) : -173.37 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.367

(partial model without unconserved sides chains): PDB file : Tito_5G4H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5G4H-query.scw PDB file : Tito_Scwrl_5G4H.pdb: