Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQELLAQLQAGTAKFSDVLAYIEARYQHTPTAFQNGAQHNAATENQGSAKVFSFAKLQGLDQAQTLILFAEHYASVLAPPEGTDHQNIRQFMQNGWDGVKFEGQALTEK 5LC5 Chain:S ((23-49)) -------------------------------------------------------------------------------CQRSPGSQGVRDFIEKRYVELKKANPD----

General information: TITO was launched using: RESULT: Template: 5LC5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain S - contact count / total energy / energy per contact / energy per residue : 14 -1924 -137.39 -71.24 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain S : 0.58 3D Compatibility (PKB) : -137.39 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.314

(partial model without unconserved sides chains): PDB file : Tito_5LC5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5LC5-query.scw PDB file : Tito_Scwrl_5LC5.pdb: