Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSEVFAMNSEQLTQILKEAFPEAEVVVS-GQAGKFDLRIVDDQFEGKRTVARQQAVYAPLNTYIASGEVHAVTIRAMTKDEWRKASLFGA 3TR3 Chain:A ((5-81)) ------VTTHDIKQWIETGLSESRVISAEGDGHHFEAVVLCPTFEGQTALTRHRLVYNALGSHMQS-DIHALSLKTYTPDEYER------

General information: TITO was launched using: RESULT: Template: 3TR3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 316 -11448 -36.23 -150.63 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.80 3D Compatibility (PKB) : -36.23 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.582

(partial model without unconserved sides chains): PDB file : Tito_3TR3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3TR3-query.scw PDB file : Tito_Scwrl_3TR3.pdb: