Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------------------------------MVQNSQKWLKTVIEKKEKALDIQGLFTNFRFPRKFSVFIF---------------------------------------------------------
4A2N Chain:B ((1-192))MNENLWKICFIVMFIIWVFVRKVYGTRAMKNKSKKKVRPNFEKSLVFLNFIGMVFLPLTAVFSSYLDSFNINLPDSIRLFALIVTFLNIGLFTKIHKDLGNNWSAILEIKDGHKLVKEGIYKNIRHPMYAHLWLWVITQGIILSNWVVLIFGIVAWAILYFIRVPKEEELLIEEFGDEYIEYMGKTGRLFPK


General information:
TITO was launched using:
RESULT:

Template: 4A2N.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 10 -412 -41.20 -10.30
target 2D structure prediction score : 0.25
Monomeric hydrophicity matching model chain B : 0.43

3D Compatibility (PKB) : -41.20
2D Compatibility (Sec. Struct. Predict.) : 0.25
1D Compatibility (Hydrophobicity) : 0.43
QMean score : 0.068

(partial model without unconserved sides chains):
PDB file : Tito_4A2N.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4A2N-query.scw
PDB file : Tito_Scwrl_4A2N.pdb: