Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ICDIVIRFEGAVVETGTMGPSTAKTFNLITDQISITVDHNCNITHWTQVEKFTVSSTLRNPP---AAAAARR 1G92 Chain:A ((1-25)) -----------------------------------------------FLPLLILGSLLMTPPVIQAIHDAQR

General information: TITO was launched using: RESULT: Template: 1G92.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 30 -1291 -43.02 -58.66 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -43.02 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.634

(partial model without unconserved sides chains): PDB file : Tito_1G92.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1G92-query.scw PDB file : Tito_Scwrl_1G92.pdb: