Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence FHFREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY 5FI4 Chain:B ((46-122)) ---REEVNEKLRDTADGTFLVRDAST---GDYTLTLRKGGNNKLIKIF--DGKYGFS-PLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 5FI4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 197 -22172 -112.55 -351.94 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain B : 0.96 3D Compatibility (PKB) : -112.55 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.96 QMean score : 0.871

(partial model without unconserved sides chains): PDB file : Tito_5FI4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FI4-query.scw PDB file : Tito_Scwrl_5FI4.pdb: