Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFD 4H1O Chain:A ((133-234)) WFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRT----SNDGKS-KVTHVMIRCQELKYDVGGGERFD

General information: TITO was launched using: RESULT: Template: 4H1O.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 229 -27199 -118.77 -383.08 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -118.77 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.577

(partial model without unconserved sides chains): PDB file : Tito_4H1O.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4H1O-query.scw PDB file : Tito_Scwrl_4H1O.pdb: