Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERE--NVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCY 4D8K Chain:A ((77-158)) FFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGE-VVKHYKIRNLDNGGFYISP-RITFPGLHELVRHY

General information: TITO was launched using: RESULT: Template: 4D8K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 273 -11514 -42.18 -143.93 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -42.18 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.722

(partial model without unconserved sides chains): PDB file : Tito_4D8K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4D8K-query.scw PDB file : Tito_Scwrl_4D8K.pdb: