Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGPLNRADAESLLSLCKEGSYLVRLSETNPQDCSLSLRSSQGFLHLKFARTRENQVVLGQHSGPFPSVPELVLHY 5DC0 Chain:B ((146-221)) WYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESR-FNTLAELVHHH

General information: TITO was launched using: RESULT: Template: 5DC0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 270 -39546 -146.47 -520.34 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain B : 0.82 3D Compatibility (PKB) : -146.47 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.685

(partial model without unconserved sides chains): PDB file : Tito_5DC0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5DC0-query.scw PDB file : Tito_Scwrl_5DC0.pdb: