Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKK-NDSGQ-WYVAERHAFQSIPELIWYH 2K7A Chain:B ((239-322)) WYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYH

General information: TITO was launched using: RESULT: Template: 2K7A.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 292 -21778 -74.58 -265.58 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain B : 0.88 3D Compatibility (PKB) : -74.58 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.88 QMean score : 0.658

(partial model without unconserved sides chains): PDB file : Tito_2K7A.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2K7A-query.scw PDB file : Tito_Scwrl_2K7A.pdb: