Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLIVLISVIVAFLYHKITEYVNNRKIDIVIFLSLLISHFIWNYYFLPIEILIAISGANLLLSFLKKLQTK 1IFK Chain:A ((29-49)) -------------------------------------------------LVVLVVGATVGIKLFKKFVSR

General information: TITO was launched using: RESULT: Template: 1IFK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -5 -2.25 -0.21 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.45 3D Compatibility (PKB) : -2.25 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.45 QMean score : 0.319

(partial model without unconserved sides chains): PDB file : Tito_1IFK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1IFK-query.scw PDB file : Tito_Scwrl_1IFK.pdb: