Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLEQTARLKEVKKQIARIKTVQSEAK 5DM7 Chain:V ((5-59)) -----------EMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREVAQLNTVKAE--

General information: TITO was launched using: RESULT: Template: 5DM7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain V - contact count / total energy / energy per contact / energy per residue : 86 -9312 -108.27 -169.30 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain V : 0.84 3D Compatibility (PKB) : -108.27 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.675

(partial model without unconserved sides chains): PDB file : Tito_5DM7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5DM7-query.scw PDB file : Tito_Scwrl_5DM7.pdb: