Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKD-DVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK
5LMR Chain:W ((1-70))-AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYR--


General information:
TITO was launched using:
RESULT:

Template: 5LMR.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 276 6628 24.01 96.06
target 2D structure prediction score : 0.51
Monomeric hydrophicity matching model chain W : 0.87

3D Compatibility (PKB) : 24.01
2D Compatibility (Sec. Struct. Predict.) : 0.51
1D Compatibility (Hydrophobicity) : 0.87
QMean score : 0.638

(partial model without unconserved sides chains):
PDB file : Tito_5LMR.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5LMR-query.scw
PDB file : Tito_Scwrl_5LMR.pdb: