Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKP-DRNEGNRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQQGRFASVQSPFGRG 2VZ4 Chain:A ((2-66)) ------------YSVGQVAGFAGVTVRTLHHYDDIGLLVPSERSHAGHRRYSDADLDRLQQILFYRELGFPL-----------------------------------------------

General information: TITO was launched using: RESULT: Template: 2VZ4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 173 -20418 -118.02 -346.06 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -118.02 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.619

(partial model without unconserved sides chains): PDB file : Tito_2VZ4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2VZ4-query.scw PDB file : Tito_Scwrl_2VZ4.pdb: