Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVMNLLFFREIEKTKASNFIQLSDWIATDSARNQLILKDILAQVAEGRNILVLVNRIQQIDVFEKLLKEKEVDDCYIISGKTKVRERERVYWRR 5JXT Chain:A ((79-145)) ------------------------HLIYNAGKMVVLDKLLKRIQKQGSRVLIFSQMSRLLDILEDYCVF-RGYKYCRIDGSTAHEDRIAAID--

General information: TITO was launched using: RESULT: Template: 5JXT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 136 -22428 -164.91 -334.75 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -164.91 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.685

(partial model without unconserved sides chains): PDB file : Tito_5JXT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5JXT-query.scw PDB file : Tito_Scwrl_5JXT.pdb: