Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKMATDKNRIMISLDDKNLEKLENLVEDVRDRRGMRLTKSQVIELLLNTVDYFDDIMGAIYSKK 3V21 Chain:H ((45-87)) -----------------ENLDKLENYVKDVVKAKGLAIPTSGAFS---NTRGTWFEVMIAIQS--

General information: TITO was launched using: RESULT: Template: 3V21.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 58 -6486 -111.82 -150.83 target 2D structure prediction score : 0.91 Monomeric hydrophicity matching model chain H : 0.69 3D Compatibility (PKB) : -111.82 2D Compatibility (Sec. Struct. Predict.) : 0.91 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.699

(partial model without unconserved sides chains): PDB file : Tito_3V21.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3V21-query.scw PDB file : Tito_Scwrl_3V21.pdb: