Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGVVGKQSSSFSLLFWLFSLSSGKVTCFKSGSLGNSSNILPKLSHFVNFTAIGVPRF 4ISN Chain:B ((19-44)) ------------FPRWYYDPTEQICKSFVYGGCLGNKN-------------------

General information: TITO was launched using: RESULT: Template: 4ISN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 44 -3308 -75.18 -127.23 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain B : 0.50 3D Compatibility (PKB) : -75.18 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.921

(partial model without unconserved sides chains): PDB file : Tito_4ISN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ISN-query.scw PDB file : Tito_Scwrl_4ISN.pdb: