Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFVNRLMAILNPIMMGISSGLSVAIYWIGAYVINDAAPIARLPFFSDMIVFMSYAM 3B60 Chain:D ((247-291)) -----ASSISDPIIQLIASLALAFVLYAASFPSVMDS----LT-AGTITVVFSSM-

General information: TITO was launched using: RESULT: Template: 3B60.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 55 -15408 -280.15 -342.40 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain D : 0.66 3D Compatibility (PKB) : -280.15 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.009

(partial model without unconserved sides chains): PDB file : Tito_3B60.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3B60-query.scw PDB file : Tito_Scwrl_3B60.pdb: