Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALLITSDCIN--CDMCLPECPNTAIFEGNKVYEIDPLRCTECVGFYDAPTCKAVCPIDCIKQDPAHIENKEQLLEKFKGLNLIGSFSS 1BWE Chain:A ((1-74)) -AYVITEPCIGTKCASCVEVCPVDCIHEGEDQYYIDPDVCIDC------GACEAVCPVSAIYHEDFVPEEWKSYIQKNRDF--------

General information: TITO was launched using: RESULT: Template: 1BWE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 320 2296 7.18 31.89 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 7.18 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.557

(partial model without unconserved sides chains): PDB file : Tito_1BWE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BWE-query.scw PDB file : Tito_Scwrl_1BWE.pdb: