Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFVALSFDWVFFFGVNMDTIEAKKNLNALCNEIEKLQNLSRSLMTAKEMLDIDAKIKRHKEQVKNIRSNLHA 5J0K Chain:B ((23-65)) --------------------ELAKRLKELLRELERLQ---REGSSDEDVRELLREIKELVEEIEKL------

General information: TITO was launched using: RESULT: Template: 5J0K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 64 -10267 -160.42 -238.77 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain B : 0.63 3D Compatibility (PKB) : -160.42 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.749

(partial model without unconserved sides chains): PDB file : Tito_5J0K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5J0K-query.scw PDB file : Tito_Scwrl_5J0K.pdb: