Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------MARNADYIDIAG-FTIAPQTLLPYGHLYNASLAGNQLNSAHGFAGPILAAPIWLINKPER-FFAIAPYLYVPIGTYHSDEALNIDENRWKFDLQLGVFNNVAMIFLPKSRPMLFDMVHMMILLE--------------------------------------------------------------------------------------------------------
4RL8 Chain:A ((3-269))EVDPGDYEALPVGATIGVVYYQHSTTDSAYANGHKVSSDFKLTSNVGILRLLHVYQLTDRLTLEPQFLLPFGRV-SSSGDASALGDTSGVGDLTLTAPLKYRLNEANDILGATVYLTAPTGNYNRDDALNLGENRWKVDLQAAYVKHL-------GEKWAVDLVGDAIWYSDNDDFGSSSARREQDVSYGAQLMGRYIVDPGTSLAIGLGHTWGGENQIDGTAQDDRAETTNFRVTANKFFTAKDQLQMQLGRDLAVENGPKENFRLNLRYVRVF


General information:
TITO was launched using:
RESULT:

Template: 4RL8.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 403 -12597 -31.26 -110.50
target 2D structure prediction score : 0.49
Monomeric hydrophicity matching model chain A : 0.65

3D Compatibility (PKB) : -31.26
2D Compatibility (Sec. Struct. Predict.) : 0.49
1D Compatibility (Hydrophobicity) : 0.65
QMean score : 0.077

(partial model without unconserved sides chains):
PDB file : Tito_4RL8.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4RL8-query.scw
PDB file : Tito_Scwrl_4RL8.pdb: