Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYLKLLLYRLNESGHPIEFEKANLP-----QGLSAEIADSFRGWGIELSGKIAKSTAF-- 1OW5 Chain:A ((23-82)) PFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQ

General information: TITO was launched using: RESULT: Template: 1OW5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 170 -9962 -58.60 -187.96 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -58.60 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.484

(partial model without unconserved sides chains): PDB file : Tito_1OW5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OW5-query.scw PDB file : Tito_Scwrl_1OW5.pdb: