Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKRKKQVIPMYVVKVMHGYIDKTGCRTREKNLDNLLIFKDKKESEAFAKRIGGRVKPIQEVRPD 5N91 Chain:A ((90-112)) ----------------------------------GLNFGSKEDANVFASAMMHALEV-------

General information: TITO was launched using: RESULT: Template: 5N91.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 14 -2134 -152.43 -92.78 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -152.43 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.864

(partial model without unconserved sides chains): PDB file : Tito_5N91.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5N91-query.scw PDB file : Tito_Scwrl_5N91.pdb: