Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFYPLFFQSYPRSFTQYLWKKKIKYFHLKTMIFPKVFHKKFTVSK 5CMZ Chain:B ((2-33)) -------------MTWEEWDKKIEELIKKSEELIKKIEEQIKKQE

General information: TITO was launched using: RESULT: Template: 5CMZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 4 65 16.25 2.03 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : 16.25 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.078

(partial model without unconserved sides chains): PDB file : Tito_5CMZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5CMZ-query.scw PDB file : Tito_Scwrl_5CMZ.pdb: